Lineage for d5tqza_ (5tqz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813156Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)
  6. 2813268Protein automated matches [190387] (4 species)
    not a true protein
  7. 2813269Species Artocarpus altilis [TaxId:194251] [336810] (3 PDB entries)
  8. 2813270Domain d5tqza_: 5tqz A: [336847]
    automated match to d1j4ta_
    complexed with glc

Details for d5tqza_

PDB Entry: 5tqz (more details), 1.6 Å

PDB Description: frutapin complexed with alpha-d-glucose
PDB Compounds: (A:) Frutapin

SCOPe Domain Sequences for d5tqza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqza_ b.77.3.1 (A:) automated matches {Artocarpus altilis [TaxId: 194251]}
masqtitvgpwggpggnewddgsytgiriielsykeaigsfsviydlngepfsgskhtsk
lpytnvkielqfpeeflvsvsgytapfsslatrtpvvrslkfktnkgrtfgpygeedgty
fnlpienglvvgfkgrtgdlldaigvhmal

SCOPe Domain Coordinates for d5tqza_:

Click to download the PDB-style file with coordinates for d5tqza_.
(The format of our PDB-style files is described here.)

Timeline for d5tqza_: