Lineage for d1d8ya1 (1d8y A:324-518)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182249Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 182436Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (4 proteins)
  6. 182459Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
  7. 182465Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 182469Domain d1d8ya1: 1d8y A:324-518 [33684]
    Other proteins in same PDB: d1d8ya2

Details for d1d8ya1

PDB Entry: 1d8y (more details), 2.08 Å

PDB Description: crystal structure of the complex of dna polymerase i klenow fragment with dna

SCOP Domain Sequences for d1d8ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8ya1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli}
misydnyvtildeetlkawiaklekapvfafatatdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOP Domain Coordinates for d1d8ya1:

Click to download the PDB-style file with coordinates for d1d8ya1.
(The format of our PDB-style files is described here.)

Timeline for d1d8ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d8ya2