SCOPe 2.06: Domain d2kfza1: 2kfz A:324-518

Lineage for d2kfza1 (2kfz A:324-518)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)

8. Domain d2kfza1: 2kfz A:324-518 [33683]
   Other proteins in same PDB: d2kfza2
   protein/DNA complex; complexed with mg, zn

Details for d2kfza1

PDB Entry: 2kfz, 2.03 Å

PDB Description: klenow fragment with bridging-sulfur substrate and zinc only

PDB Compounds: (A:) klenow fragment of DNA polymerase I

SCOPe Domain Sequences for d2kfza1:

Sequence; same for both SEQRES and ATOM records:

>d2kfza1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

Timeline for d2kfza1:

• d2kfza1 first appeared (with stable ids) in SCOP 1.55
  
• d2kfza1 appears in SCOPe 2.05
  
• d2kfza1 appears in SCOPe 2.07
  
• d2kfza1 appears in the current release, SCOPe 2.08