SCOPe 2.08: Domain d5kkxa2: 5kkx A:469-612

Lineage for d5kkxa2 (5kkx A:469-612)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.0: automated matches [191664] (1 protein)
   not a true family

6. Protein automated matches [191257] (6 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:487] [256195] (2 PDB entries)

8. Domain d5kkxa2: 5kkx A:469-612 [336820]
   Other proteins in same PDB: d5kkxa1, d5kkxb1
   automated match to d3pqsa4
   complexed with gol; mutant

Details for d5kkxa2

PDB Entry: 5kkx, 2.1 Å

PDB Description: crystal structure of a tbpb c-lobe mutant from neisseria meningitidis m982

PDB Compounds: (A:) TbpB

SCOPe Domain Sequences for d5kkxa2:

Sequence, based on SEQRES records:

>d5kkxa2 f.4.1.0 (A:469-612) automated matches {Neisseria meningitidis [TaxId: 487]}
dekeiptdqnvvyrgswyghiangtswsgnasdkeggnraeftvnfadkkitgkltaenr
qaqtftiegmiqgngfegtaktaesgfdldqknttrtpkayitdakvkggfygpkaeelg
gwfayhksdngsatvvfgakrqqp

Sequence, based on observed residues (ATOM records):

>d5kkxa2 f.4.1.0 (A:469-612) automated matches {Neisseria meningitidis [TaxId: 487]}
dekeiptdqnvvyrgswyghiangtswsgnasdkeggnraeftvnfadkkitgkltaenr
qaqtftiegmiqgngfegtaktaesgfdldqkntrtpkayitdakvkggfygpkaeelgg
wfayhksdngsatvvfgakrqqp

Timeline for d5kkxa2:

• d5kkxa2 first appeared in SCOPe 2.06
  
• d5kkxa2 appears in SCOPe 2.07