Lineage for d5xdqq_ (5xdq Q:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2577986Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) (S)
    automatically mapped to Pfam PF02936
  5. 2577987Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins)
  6. 2577988Protein Mitochondrial cytochrome c oxidase subunit IV [81404] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2577989Species Cow (Bos taurus) [TaxId:9913] [81403] (23 PDB entries)
  8. 2578004Domain d5xdqq_: 5xdq Q: [336777]
    Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_
    automated match to d1v54d_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqq_

PDB Entry: 5xdq (more details), 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution
PDB Compounds: (Q:) cytochrome c oxidase subunit 4 isoform 1, mitochondrial

SCOPe Domain Sequences for d5xdqq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdqq_ f.23.1.1 (Q:) Mitochondrial cytochrome c oxidase subunit IV {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk

SCOPe Domain Coordinates for d5xdqq_:

Click to download the PDB-style file with coordinates for d5xdqq_.
(The format of our PDB-style files is described here.)

Timeline for d5xdqq_: