Lineage for d5xdqo2 (5xdq O:91-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771043Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 2771044Protein Cytochrome c oxidase [49544] (4 species)
  7. 2771045Species Cow (Bos taurus) [TaxId:9913] [49545] (50 PDB entries)
  8. 2771095Domain d5xdqo2: 5xdq O:91-227 [336746]
    Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdqk_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqx_, d5xdqy_, d5xdqz_
    automated match to d1v54b1
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqo2

PDB Entry: 5xdq (more details), 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5xdqo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdqo2 b.6.1.2 (O:91-227) Cytochrome c oxidase {Cow (Bos taurus) [TaxId: 9913]}
nnpsltvktmghqwywsyeytdyedlsfdsymiptselkpgelrllevdnrvvlpmemti
rmlvssedvlhswavpslglktdaipgrlnqttlmssrpglyygqcseicgsnhsfmpiv
lelvplkyfekwsasml

SCOPe Domain Coordinates for d5xdqo2:

Click to download the PDB-style file with coordinates for d5xdqo2.
(The format of our PDB-style files is described here.)

Timeline for d5xdqo2: