SCOPe 2.06: Domain d5w8pa1: 5w8p A:13-379

Lineage for d5w8pa1 (5w8p A:13-379)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [336741] (1 PDB entry)

8. Domain d5w8pa1: 5w8p A:13-379 [336742]
   Other proteins in same PDB: d5w8pa2, d5w8pb2
   automated match to d2pl5a1
   complexed with gol, k, po4

Details for d5w8pa1

PDB Entry: 5w8p, 1.69 Å

PDB Description: homoserine transacetylase metx from mycobacterium abscessus

PDB Compounds: (A:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d5w8pa1:

Sequence; same for both SEQRES and ATOM records:

>d5w8pa1 c.69.1.0 (A:13-379) automated matches {Mycobacterium abscessus [TaxId: 561007]}
alpqgdeiayvpigsitlesgaviddvtiavqswgelsprrdnvvfvchaltadshvvgp
agpdhitggwwegiigpgaaidtdhwcavatnvlggcrgttgptslardgkpwgsrfpev
svrdqvnadvaalaqlgitevaavvggsmggaralewavmhpdavraalvlavgaratgd
qigtqstqiaaiqtdpdwqggdyhgsgrspgkglnlarriahltyrgeveldtrfgndpq
vgpdgpedpwadgryavqsylehqgnkfvrrfdagsyvilteslnrhdvgrgrggvekal
rgcpvpvvvggitsdrlyplrlqeeladllpgctglrvvesvhghdafliefdavselvr
etlalak

Timeline for d5w8pa1:

• d5w8pa1 is new in SCOPe 2.06-stable
  
• d5w8pa1 appears in SCOPe 2.07
  
• d5w8pa1 appears in the current release, SCOPe 2.08