Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [336741] (1 PDB entry) |
Domain d5w8pa1: 5w8p A:13-379 [336742] Other proteins in same PDB: d5w8pa2, d5w8pb2 automated match to d2pl5a1 complexed with gol, k, po4 |
PDB Entry: 5w8p (more details), 1.69 Å
SCOPe Domain Sequences for d5w8pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w8pa1 c.69.1.0 (A:13-379) automated matches {Mycobacterium abscessus [TaxId: 561007]} alpqgdeiayvpigsitlesgaviddvtiavqswgelsprrdnvvfvchaltadshvvgp agpdhitggwwegiigpgaaidtdhwcavatnvlggcrgttgptslardgkpwgsrfpev svrdqvnadvaalaqlgitevaavvggsmggaralewavmhpdavraalvlavgaratgd qigtqstqiaaiqtdpdwqggdyhgsgrspgkglnlarriahltyrgeveldtrfgndpq vgpdgpedpwadgryavqsylehqgnkfvrrfdagsyvilteslnrhdvgrgrggvekal rgcpvpvvvggitsdrlyplrlqeeladllpgctglrvvesvhghdafliefdavselvr etlalak
Timeline for d5w8pa1: