Lineage for d5w3od_ (5w3o D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 2358614Domain d5w3od_: 5w3o D: [336740]
    Other proteins in same PDB: d5w3ob_, d5w3oe_
    automated match to d3r0ma_

Details for d5w3od_

PDB Entry: 5w3o (more details), 3.01 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (33 degrees celsius, molar ratio 1:3, empty particle)
PDB Compounds: (D:) C5 antibody variable heavy domain

SCOPe Domain Sequences for d5w3od_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3od_ b.1.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqlaesgpalvapsqalsitctvagfsltaygvawvrqppgaglewlgaiwaagatdyn
aalksrasiakdnsksqvflamaslatadtaayycarewdaygdywgqgttvtvsa

SCOPe Domain Coordinates for d5w3od_:

Click to download the PDB-style file with coordinates for d5w3od_.
(The format of our PDB-style files is described here.)

Timeline for d5w3od_: