Lineage for d5xdqk_ (5xdq K:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630638Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family) (S)
    automatically mapped to Pfam PF05392
  5. 2630639Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (2 proteins)
  6. 2630640Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630641Species Cow (Bos taurus) [TaxId:9913] [81420] (29 PDB entries)
  8. 2630658Domain d5xdqk_: 5xdq K: [336734]
    Other proteins in same PDB: d5xdqa_, d5xdqb1, d5xdqb2, d5xdqc_, d5xdqd_, d5xdqe_, d5xdqf_, d5xdqg_, d5xdqh_, d5xdqi_, d5xdqj_, d5xdql_, d5xdqm_, d5xdqn_, d5xdqo1, d5xdqo2, d5xdqp_, d5xdqq_, d5xdqr_, d5xdqs_, d5xdqt_, d5xdqu_, d5xdqv_, d5xdqw_, d5xdqy_, d5xdqz_
    automated match to d1v54k_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, per, pgv, psc, tgl, zn

Details for d5xdqk_

PDB Entry: 5xdq (more details), 1.77 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state with ph 7.3 at 1.77 angstrom resolution
PDB Compounds: (K:) cytochrome c oxidase subunit 7b, mitochondrial

SCOPe Domain Sequences for d5xdqk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xdqk_ f.23.5.1 (K:) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

SCOPe Domain Coordinates for d5xdqk_:

Click to download the PDB-style file with coordinates for d5xdqk_.
(The format of our PDB-style files is described here.)

Timeline for d5xdqk_: