Lineage for d5w3le_ (5w3l E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035305Domain d5w3le_: 5w3l E: [336720]
    Other proteins in same PDB: d5w3la_, d5w3lb_, d5w3lg_
    automated match to d3r0ma_

Details for d5w3le_

PDB Entry: 5w3l (more details), 2.71 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (4 degrees celsius, molar ratio 1:3, full particle)
PDB Compounds: (E:) C5 antibody variable heavy domain

SCOPe Domain Sequences for d5w3le_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3le_ b.1.1.0 (E:) automated matches {Mus musculus [TaxId: 10090]}
avqlaesgpalvapsqalsitctvagfsltaygvawvrqppgaglewlgaiwaagatdyn
aalksrasiakdnsksqvflamaslatadtaayycarewdaygdywgqgttvtvsa

SCOPe Domain Coordinates for d5w3le_:

Click to download the PDB-style file with coordinates for d5w3le_.
(The format of our PDB-style files is described here.)

Timeline for d5w3le_: