Lineage for d5w3me_ (5w3m E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760433Domain d5w3me_: 5w3m E: [336704]
    Other proteins in same PDB: d5w3ma_, d5w3mb_, d5w3mg_
    automated match to d3r0ma_

Details for d5w3me_

PDB Entry: 5w3m (more details), 2.26 Å

PDB Description: cryoem structure of rhinovirus b14 in complex with c5 fab (33 degrees celsius, molar ratio 1:1, full particle)
PDB Compounds: (E:) C5 antibody variable heavy domain

SCOPe Domain Sequences for d5w3me_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w3me_ b.1.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avqlaesgpalvapsqalsitctvagfsltaygvawvrqppgaglewlgaiwaagatdyn
aalksrasiakdnsksqvflamaslatadtaayycarewdaygdywgqgttvtvsa

SCOPe Domain Coordinates for d5w3me_:

Click to download the PDB-style file with coordinates for d5w3me_.
(The format of our PDB-style files is described here.)

Timeline for d5w3me_: