Lineage for d5nota_ (5not A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073956Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2073957Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2073958Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2073959Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2073974Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (113 PDB entries)
    Uniprot P05092
  8. 2074014Domain d5nota_: 5not A: [336699]
    automated match to d1w8ma_
    complexed with 938

Details for d5nota_

PDB Entry: 5not (more details), 1.45 Å

PDB Description: structure of cyclophilin a in complex with 4-chloropyrimidin-5-amine
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d5nota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nota_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d5nota_:

Click to download the PDB-style file with coordinates for d5nota_.
(The format of our PDB-style files is described here.)

Timeline for d5nota_: