Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (20 species) not a true protein |
Species Polyporus squamosus [TaxId:5640] [233246] (2 PDB entries) |
Domain d5muaa2: 5mua A:149-286 [336677] Other proteins in same PDB: d5muaa1, d5muab1 automated match to d3phza2 complexed with ca, dms, e64, gal |
PDB Entry: 5mua (more details), 1.49 Å
SCOPe Domain Sequences for d5muaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5muaa2 d.3.1.0 (A:149-286) automated matches {Polyporus squamosus [TaxId: 5640]} lsqtganvhatllacpalrqdfksylsdglylvltrdqissiwqasglgstpwrseifdc ddfatvfkgavakwgnenfkangfallcglmfgskssgahaynwfvergnfstvtffepq ngtysanawdykayfglf
Timeline for d5muaa2: