Lineage for d5muaa1 (5mua A:2-148)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2062118Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2062119Protein automated matches [226913] (9 species)
    not a true protein
  7. 2062184Species Polyporus squamosus [TaxId:5640] [233243] (2 PDB entries)
  8. 2062187Domain d5muaa1: 5mua A:2-148 [336676]
    Other proteins in same PDB: d5muaa2, d5muab2
    automated match to d3phza1
    complexed with ca, dms, e64, gal

Details for d5muaa1

PDB Entry: 5mua (more details), 1.49 Å

PDB Description: psl1a-e64 complex
PDB Compounds: (A:) Ricin B-related lectin

SCOPe Domain Sequences for d5muaa1:

Sequence, based on SEQRES records: (download)

>d5muaa1 b.42.2.0 (A:2-148) automated matches {Polyporus squamosus [TaxId: 5640]}
sfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadtyt
vrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtlln
gdgggtgtvvgwqnitnntsqnwtfqk

Sequence, based on observed residues (ATOM records): (download)

>d5muaa1 b.42.2.0 (A:2-148) automated matches {Polyporus squamosus [TaxId: 5640]}
sfqghgiyyiasayvantrlalsespdviissdavdplnnlwliepvgeadtytvrnafa
gsymdlaghaatdgtaiigyrptggdnqkwiisqwkiksketgtfvtllngtvvgwqnit
nntsqnwtfqk

SCOPe Domain Coordinates for d5muaa1:

Click to download the PDB-style file with coordinates for d5muaa1.
(The format of our PDB-style files is described here.)

Timeline for d5muaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5muaa2