SCOPe 2.06: Domain d5ldna2: 5ldn A:635-946

Lineage for d5ldna2 (5ldn A:635-946)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.2: Adenovirus hexon [49753] (2 proteins)
   each domain is heavily decorated with many insertions

6. Protein automated matches [336628] (1 species)
   not a true protein

7. Species Human adenovirus 5 [TaxId:28285] [336629] (1 PDB entry)

8. Domain d5ldna2: 5ldn A:635-946 [336631]
   Other proteins in same PDB: d5ldnl1, d5ldnl2
   automated match to d1p2za2

Details for d5ldna2

PDB Entry: 5ldn, 2.7 Å

PDB Description: a viral capsid:antibody complex

PDB Compounds: (A:) Hexon protein,hexon capsid

SCOPe Domain Sequences for d5ldna2:

Sequence; same for both SEQRES and ATOM records:

>d5ldna2 b.121.2.2 (A:635-946) automated matches {Human adenovirus 5 [TaxId: 28285]}
ndtndqsfndylsaanmlypipanatnvpisipsrnwaafrgwaftrlktketpslgsgy
dpyytysgsipyldgtfylnhtfkkvaitfdssvswpgndrlltpnefeikrsvdgegyn
vaqcnmtkdwflvqmlanynigyqgfyipesykdrmysffrnfqpmsrqvvddtkykdyq
qvgilhqhnnsgfvgylaptmregqaypanfpypligktavdsitqkkflcdrtlwripf
ssnfmsmgaltdlgqnllyansahaldmtfevdpmdeptllyvlfevfdvvrvhrphrgv
ietvylrtpfsa

Timeline for d5ldna2:

• d5ldna2 is new in SCOPe 2.06-stable
  
• d5ldna2 appears in SCOPe 2.07
  
• d5ldna2 appears in the current release, SCOPe 2.08