Lineage for d1bhl__ (1bhl -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 25007Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 25212Superfamily c.55.3: Ribonuclease H-like [53098] (6 families) (S)
  5. 25292Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (1 protein)
  6. 25293Protein Retroviral integrase, catalytic domain [53108] (3 species)
  7. 25294Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (14 PDB entries)
  8. 25311Domain d1bhl__: 1bhl - [33662]

Details for d1bhl__

PDB Entry: 1bhl (more details), 2.2 Å

PDB Description: cacodylated catalytic domain of hiv-1 integrase

SCOP Domain Sequences for d1bhl__:

Sequence, based on SEQRES records: (download)

>d1bhl__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldxthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaaxwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatd

Sequence, based on observed residues (ATOM records): (download)

>d1bhl__ c.55.3.2 (-) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1}
spgiwqldthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtdn
gsnftsttvkaawwagikqmnkelkkiigqvrdqaehlktavqmavfihnhkrkggiggy
sagerivdiiatd

SCOP Domain Coordinates for d1bhl__:

Click to download the PDB-style file with coordinates for d1bhl__.
(The format of our PDB-style files is described here.)

Timeline for d1bhl__: