Lineage for d5gvpa_ (5gvp A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147071Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2147072Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2148410Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2148411Protein automated matches [190151] (121 species)
    not a true protein
  7. 2149126Species Plasmodium vivax [TaxId:126793] [261543] (17 PDB entries)
  8. 2149148Domain d5gvpa_: 5gvp A: [336612]
    automated match to d4pffa_
    complexed with cl, gcf, plg

Details for d5gvpa_

PDB Entry: 5gvp (more details), 2.26 Å

PDB Description: plasmodium vivax shmt bound with plp-glycine and gs654
PDB Compounds: (A:) Serine hydroxymethyltransferase, putative

SCOPe Domain Sequences for d5gvpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gvpa_ c.67.1.0 (A:) automated matches {Plasmodium vivax [TaxId: 126793]}
mfnnepleqidkelhdiladeekrqretinliasenltngavreclgnrvsnkysegypk
kryyggndfidkieelcqkraleafnvsdeewgvnvqplsgsaanvqalyalvgvkgkim
gmhlcsgghlthgffdekkkvsitsdmfesklykcnsqgyvdldavremalsfkpkviic
gytsyprdidyqqfrqicdevnaylfadishissfvacnilnnpflhadvvtttthkilr
gprsaliffnkkrnpgieqkinsavfpsfqggphnnkiaavacqlkevhspafkeytqqv
llnskalakaliskqidlvtngtdnhlivvdlrkfsitgsklqetcnainvslnkntips
dvdcvspsgvrigtpamttrgakekdmefiadvlaraikitvdlqeqygkklvdfkkglp
gnaqlqqlkqevvtwagalpfp

SCOPe Domain Coordinates for d5gvpa_:

Click to download the PDB-style file with coordinates for d5gvpa_.
(The format of our PDB-style files is described here.)

Timeline for d5gvpa_: