Lineage for d5mvva2 (5mvv A:148-366)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2137195Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2137589Protein automated matches [226905] (13 species)
    not a true protein
  7. 2137794Species Plasmodium falciparum [TaxId:36329] [336601] (1 PDB entry)
  8. 2137795Domain d5mvva2: 5mvv A:148-366 [336602]
    Other proteins in same PDB: d5mvva1, d5mvvg_
    automated match to d3ub5a2
    complexed with atp, ca, cd, scn

Details for d5mvva2

PDB Entry: 5mvv (more details), 1.4 Å

PDB Description: crystal structure of plasmodium falciparum actin i- gelsolin segment 1 -cdatp complex
PDB Compounds: (A:) Actin-1

SCOPe Domain Sequences for d5mvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mvva2 c.55.1.1 (A:148-366) automated matches {Plasmodium falciparum [TaxId: 36329]}
rttgivldsgdgvshtvpiyegyalphaimrldlagrdlteylmkilhergygfstsaek
eivrdikeklcyialnfdeemktseqssdieksyelpdgniitvgnerfrcpealfqpsf
lgkeaagihtttfnsikkcdvdirkdlygnivlsggttmyegigerltrdittlapstmk
ikvvapperkysvwiggsilsslstfqqmwitkeeydes

SCOPe Domain Coordinates for d5mvva2:

Click to download the PDB-style file with coordinates for d5mvva2.
(The format of our PDB-style files is described here.)

Timeline for d5mvva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5mvva1
View in 3D
Domains from other chains:
(mouse over for more information)
d5mvvg_