Lineage for d5kv9b_ (5kv9 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2398194Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2398195Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2398492Protein automated matches [193245] (17 species)
    not a true protein
  7. 2398501Species Human parainfluenza virus 3 [TaxId:11216] [270133] (5 PDB entries)
  8. 2398506Domain d5kv9b_: 5kv9 B: [336573]
    automated match to d4xjqa_
    complexed with ca, edo, i57, nag

Details for d5kv9b_

PDB Entry: 5kv9 (more details), 2 Å

PDB Description: crystal structure of a hpiv haemagglutinin-neuraminidase-inhibitor complex
PDB Compounds: (B:) hemagglutinin-neuraminidase

SCOPe Domain Sequences for d5kv9b_:

Sequence, based on SEQRES records: (download)

>d5kv9b_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit
dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk
srvnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqp
mlfkteipkscs

Sequence, based on observed residues (ATOM records): (download)

>d5kv9b_ b.68.1.1 (B:) automated matches {Human parainfluenza virus 3 [TaxId: 11216]}
rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind
liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal
lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp
svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns
iivvdknsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiiditdy
sdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqksr
vnpvitystatervnelairnktlsagytttscithynkgycfhiveinhksldtfqpml
fkteipkscs

SCOPe Domain Coordinates for d5kv9b_:

Click to download the PDB-style file with coordinates for d5kv9b_.
(The format of our PDB-style files is described here.)

Timeline for d5kv9b_: