Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (70 species) not a true protein |
Species Serratia marcescens [TaxId:615] [327556] (4 PDB entries) |
Domain d5gs8a_: 5gs8 A: [336561] automated match to d1buea_ complexed with cl, na, so4 |
PDB Entry: 5gs8 (more details), 1.59 Å
SCOPe Domain Sequences for d5gs8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gs8a_ e.3.1.0 (A:) automated matches {Serratia marcescens [TaxId: 615]} gtdslknsiekylkdkkakvgvavlgiednfklnvnekhhypmqstykfhlalavldkld kenisvdkklfvkksdlqpntwsplkdkypngnlelsfseiikstvshsdnngcdilfrf vggtnkvhnfisklgvknisikateeemhkawnvqytnwttpdatvqllkkfykneilsk nsydfllntmietttgpkrlkgllpdgtvvahktgssdtnnkgitaatndigiitlpngk hfaiavyvsdsseksdvnekiiaeicksvwdylvk
Timeline for d5gs8a_: