Lineage for d5givc_ (5giv C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530199Species Deinococcus radiodurans [TaxId:243230] [336537] (1 PDB entry)
  8. 2530202Domain d5givc_: 5giv C: [336546]
    automated match to d1wgza_
    complexed with act, zn

Details for d5givc_

PDB Entry: 5giv (more details), 2.4 Å

PDB Description: crystal structure of m32 carboxypeptidase from deinococcus radiodurans r1
PDB Compounds: (C:) carboxypeptidase 1

SCOPe Domain Sequences for d5givc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5givc_ d.92.1.0 (C:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
qwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharatdagygk
lldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtearpandf
grmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraalvplad
aviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlgghdvri
ttrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlwenlvgr
srafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvitrfele
remlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgytignvl
saqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgqaltagp
ylkylrgkygelygv

SCOPe Domain Coordinates for d5givc_:

Click to download the PDB-style file with coordinates for d5givc_.
(The format of our PDB-style files is described here.)

Timeline for d5givc_: