Lineage for d5givb_ (5giv B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2206178Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2206179Protein automated matches [190805] (17 species)
    not a true protein
  7. 2206198Species Deinococcus radiodurans [TaxId:243230] [336537] (1 PDB entry)
  8. 2206200Domain d5givb_: 5giv B: [336545]
    automated match to d1wgza_
    complexed with act, zn

Details for d5givb_

PDB Entry: 5giv (more details), 2.4 Å

PDB Description: crystal structure of m32 carboxypeptidase from deinococcus radiodurans r1
PDB Compounds: (B:) carboxypeptidase 1

SCOPe Domain Sequences for d5givb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5givb_ d.92.1.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
ttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharat
dagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtea
rpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraa
lvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlg
ghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlw
enlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvi
trfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgy
tignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgq
altagpylkylrgkygelygv

SCOPe Domain Coordinates for d5givb_:

Click to download the PDB-style file with coordinates for d5givb_.
(The format of our PDB-style files is described here.)

Timeline for d5givb_: