Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (20 species) not a true protein |
Species Deinococcus radiodurans [TaxId:243230] [336537] (1 PDB entry) |
Domain d5givb_: 5giv B: [336545] automated match to d1wgza_ complexed with act, zn |
PDB Entry: 5giv (more details), 2.4 Å
SCOPe Domain Sequences for d5givb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5givb_ d.92.1.0 (B:) automated matches {Deinococcus radiodurans [TaxId: 243230]} ttrqdtqwqqltehwqeladfggieallgwdqstflpagaaedrarqqsllaglrharat dagygklldaassrsdlspeqarmvqvarqdfekatripaefvrefsghvgqsysawtea rpandfgrmvpylektldlslqaasyfpefgdpldyyinesdegmtaeqvgqvfaelraa lvpladaviaagaprtdflgrgfaqerqlafgervirdygydfrrgrqdlthhpfmtrlg ghdvrittrvkeqdptdalystlheaghalyeqgvdaaflgtplgggvsagvhesqsrlw enlvgrsrafwaayfgdwrdtfpeqlagvteeemyravntvsrslirtdadeltynlhvi trfeleremlagklavrdladawhaayeqnlglrapsdvdgalqdvhwyfgpiggsfqgy tignvlsaqfyaaaeaanpgleadfarkdfsrlhgwlrenvyrhgrrwtpgelieratgq altagpylkylrgkygelygv
Timeline for d5givb_: