Lineage for d5lpuc_ (5lpu C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710220Species Human (Homo sapiens), s100a4 [TaxId:9606] [81754] (9 PDB entries)
    MTS1 protein
  8. 2710231Domain d5lpuc_: 5lpu C: [336527]
    Other proteins in same PDB: d5lpua_, d5lpub_, d5lpud2
    automated match to d1m31a_
    complexed with ca, gol

Details for d5lpuc_

PDB Entry: 5lpu (more details), 2.1 Å

PDB Description: crystal structure of annexin a2 complexed with s100a4
PDB Compounds: (C:) Protein S100-A4

SCOPe Domain Sequences for d5lpuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lpuc_ a.39.1.2 (C:) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]}
acplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsn
ldsnrdnevdfqeycvflsciammcneff

SCOPe Domain Coordinates for d5lpuc_:

Click to download the PDB-style file with coordinates for d5lpuc_.
(The format of our PDB-style files is described here.)

Timeline for d5lpuc_: