SCOPe 2.06: Domain d5kozk2: 5koz K:139-456

Lineage for d5kozk2 (5koz K:139-456)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (9 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [257017] (3 PDB entries)

8. Domain d5kozk2: 5koz K:139-456 [336487]
   Other proteins in same PDB: d5koza1, d5kozb1, d5kozc1, d5kozd1, d5koze1, d5kozf1, d5kozg1, d5kozh1, d5kozi1, d5kozj1, d5kozk1, d5kozl1
   automated match to d4lf2a2
   complexed with cap, co3, mg; mutant

Details for d5kozk2

PDB Entry: 5koz, 2.3 Å

PDB Description: structure function studies of r. palustris rubisco (k192c mutant; cabp-bound)

PDB Compounds: (K:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5kozk2:

Sequence; same for both SEQRES and ATOM records:

>d5kozk2 c.1.14.1 (K:139-456) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdficndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwrakl

Timeline for d5kozk2:

• d5kozk2 is new in SCOPe 2.06-stable
  
• d5kozk2 appears in SCOPe 2.07
  
• d5kozk2 appears in the current release, SCOPe 2.08