Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d5gksd2: 5gks D:109-209 [336449] Other proteins in same PDB: d5gksb1, d5gksd1 automated match to d2fb4l2 complexed with po4 |
PDB Entry: 5gks (more details), 2.05 Å
SCOPe Domain Sequences for d5gksd2:
Sequence, based on SEQRES records: (download)
>d5gksd2 b.1.1.2 (D:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvap
>d5gksd2 b.1.1.2 (D:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseelqankatlvclisdfypgavtvawkadgspvkagvettkpskq nkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d5gksd2: