SCOPe 2.06: Domain d5gksd1: 5gks D:2-108

Lineage for d5gksd1 (5gks D:2-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d5gksd1: 5gks D:2-108 [336448]
   Other proteins in same PDB: d5gksb2, d5gksd2
   automated match to d2mcg11
   complexed with po4

Details for d5gksd1

PDB Entry: 5gks, 2.05 Å

PDB Description: crystal structure of sle patient-derived anti-dna antibody

PDB Compounds: (D:) lambda, Fab (light chain)

SCOPe Domain Sequences for d5gksd1:

Sequence; same for both SEQRES and ATOM records:

>d5gksd1 b.1.1.1 (D:2-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqprsvsgspgqsvtisctgtssdvggynyvswyqqhpgkapkvmiydvskrpsgvp
drfsgsksgntasltisglqaedeadyyccsyagsytyvfgtgtkvtvlg

Timeline for d5gksd1:

• d5gksd1 is new in SCOPe 2.06-stable
  
• d5gksd1 appears in SCOPe 2.07
  
• d5gksd1 appears in the current release, SCOPe 2.08