Class a: All alpha proteins [46456] (289 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein automated matches [191290] (4 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries) |
Domain d5h7ba5: 5h7b A:222-266 [336436] automated match to d2otke_ |
PDB Entry: 5h7b (more details), 3.1 Å
SCOPe Domain Sequences for d5h7ba5:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7ba5 a.8.1.1 (A:222-266) automated matches {Staphylococcus aureus [TaxId: 1280]} afyeilhlpnlneeqrnafiqslkddpsqsanllaeakklndaqa
Timeline for d5h7ba5:
View in 3D Domains from same chain: (mouse over for more information) d5h7ba1, d5h7ba2, d5h7ba3, d5h7ba4 |
View in 3D Domains from other chains: (mouse over for more information) d5h7bb1, d5h7bb2, d5h7bb3, d5h7bb4 |