Lineage for d5h7ba2 (5h7b A:87-131)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986264Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1986265Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1986302Protein automated matches [191290] (4 species)
    not a true protein
  7. 1986308Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries)
  8. 1986371Domain d5h7ba2: 5h7b A:87-131 [336433]
    automated match to d2otke_

Details for d5h7ba2

PDB Entry: 5h7b (more details), 3.1 Å

PDB Description: crystal structure of a repeat protein with five protein a repeat modules
PDB Compounds: (A:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5h7ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7ba2 a.8.1.1 (A:87-131) automated matches {Staphylococcus aureus [TaxId: 1280]}
afyeilslpnlneeqrnafiqslkddpsqsanllaeakklneqqa

SCOPe Domain Coordinates for d5h7ba2:

Click to download the PDB-style file with coordinates for d5h7ba2.
(The format of our PDB-style files is described here.)

Timeline for d5h7ba2: