Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) automatically mapped to Pfam PF02216 |
Protein Immunoglobulin-binding protein A modules [46999] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries) |
Domain d5h7ba1: 5h7b A:37-86 [336432] automated match to d2otke_ |
PDB Entry: 5h7b (more details), 3.1 Å
SCOPe Domain Sequences for d5h7ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h7ba1 a.8.1.1 (A:37-86) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]} keqqnafyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqa
Timeline for d5h7ba1:
View in 3D Domains from same chain: (mouse over for more information) d5h7ba2, d5h7ba3, d5h7ba4, d5h7ba5 |
View in 3D Domains from other chains: (mouse over for more information) d5h7bb1, d5h7bb2, d5h7bb3, d5h7bb4 |