SCOPe 2.08: Domain d5i4qc2: 5i4q C:298-394

Lineage for d5i4qc2 (5i4q C:298-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families)
   probably related to the second domain and its superfamiy by a circular permutation

5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)

6. Protein automated matches [336429] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:469008] [336430] (1 PDB entry)

8. Domain d5i4qc2: 5i4q C:298-394 [336431]
   Other proteins in same PDB: d5i4qc1
   automated match to d1d8ta2
   complexed with cl, so4

Details for d5i4qc2

PDB Entry: 5i4q, 2.35 Å

PDB Description: contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3)

PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d5i4qc2:

Sequence; same for both SEQRES and ATOM records:

>d5i4qc2 b.44.1.1 (C:298-394) automated matches {Escherichia coli [TaxId: 469008]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

Timeline for d5i4qc2:

• d5i4qc2 first appeared in SCOPe 2.06
  
• d5i4qc2 appears in SCOPe 2.07