Lineage for d5i4qc1 (5i4q C:209-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793352Species Escherichia coli [TaxId:469008] [257409] (2 PDB entries)
  8. 2793354Domain d5i4qc1: 5i4q C:209-297 [336428]
    Other proteins in same PDB: d5i4qc2
    automated match to d1efca1
    complexed with cl, so4

Details for d5i4qc1

PDB Entry: 5i4q (more details), 2.35 Å

PDB Description: contact-dependent inhibition system from escherichia coli nc101 - ternary cdia/cdii/ef-tu complex (domains 2 and 3)
PDB Compounds: (C:) elongation factor tu

SCOPe Domain Sequences for d5i4qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4qc1 b.43.3.0 (C:209-297) automated matches {Escherichia coli [TaxId: 469008]}
kpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkllde
gragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d5i4qc1:

Click to download the PDB-style file with coordinates for d5i4qc1.
(The format of our PDB-style files is described here.)

Timeline for d5i4qc1:

2793354
d5i4qc1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5i4qc2