Lineage for d5xb2b_ (5xb2 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2451911Species Aquifex aeolicus [TaxId:224324] [188217] (16 PDB entries)
  8. 2451929Domain d5xb2b_: 5xb2 B: [336410]
    automated match to d4s35b_
    complexed with adp, f, mg, tmp

Details for d5xb2b_

PDB Entry: 5xb2 (more details), 2.16 Å

PDB Description: adp-mg-f-dtmp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d5xb2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xb2b_ c.37.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgvlr

SCOPe Domain Coordinates for d5xb2b_:

Click to download the PDB-style file with coordinates for d5xb2b_.
(The format of our PDB-style files is described here.)

Timeline for d5xb2b_: