SCOPe 2.06: Domain d5xb3a_: 5xb3 A:

Lineage for d5xb3a_ (5xb3 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [188217] (15 PDB entries)

8. Domain d5xb3a_: 5xb3 A: [336385]
   automated match to d4s35b_
   complexed with adp, tmp

Details for d5xb3a_

PDB Entry: 5xb3, 1.77 Å

PDB Description: adp-dtmp bound crystal structure of thymidylate kinase (aq_969) from aquifex aeolicus vf5

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d5xb3a_:

Sequence; same for both SEQRES and ATOM records:

>d5xb3a_ c.37.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mliafegidgsgkttqakklyeylkqkgyfvslyrepggtkvgevlreillteelderte
lllfeasrsklieekiipdlkrdkvvildrfvlstiayqgygkgldvefiknlnefatrg
vkpditllldipvdialrrlkeknrfenkeflekvrkgflelakeeenvvvidasgeeee
vfkeilralsgvl

Timeline for d5xb3a_:

• d5xb3a_ is new in SCOPe 2.06-stable
  
• d5xb3a_ appears in SCOPe 2.07
  
• d5xb3a_ appears in the current release, SCOPe 2.08