Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
Protein automated matches [190260] (25 species) not a true protein |
Species Enterovirus d68 [TaxId:42789] [336371] (3 PDB entries) |
Domain d5xe0a_: 5xe0 A: [336372] automated match to d4wfxa_ protein/RNA complex; complexed with gtp |
PDB Entry: 5xe0 (more details), 2.3 Å
SCOPe Domain Sequences for d5xe0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xe0a_ e.8.1.4 (A:) automated matches {Enterovirus d68 [TaxId: 42789]} geivsneksgvcinapaktklqpsvfhqvfegskepavlnskdprlktdfeeaifskytg nkimlmdeymeeavdhyvgclepldisvdpiplesamygmdglealdlttsagfpyllqg kkkrdifnrhtrdttemtkmlekygvdlpfvtfvkdelrskekvekgksrlieasslnds vamrvafgnlyatfhsnpgtatgsavgcdpdifwskipilldgeifafdytgydaslspv wfaclkkvliklgythqtsfidylchsvhlykdrkyivnggmpsgssgtsifntminnii irtllirvykgidldqfkmiaygddviasyphkidpallaeagkhyglvmtpadkgtsfv dtnwenvtflkryfraddqypflihpvmpmkeihesirwtkdprntqdhvrslcylawhn geeaynefcrkirsvpvgraltlpaysslrrkwldsf
Timeline for d5xe0a_: