SCOPe 2.08: Domain d5vtxe1: 5vtx E:11-325

Lineage for d5vtxe1 (5vtx E:11-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d5vtxe1: 5vtx E:11-325 [336357]
   Other proteins in same PDB: d5vtxa2, d5vtxb_, d5vtxc2, d5vtxd_, d5vtxe2, d5vtxf_
   automated match to d4xkga_
   complexed with nag; mutant

Details for d5vtxe1

PDB Entry: 5vtx, 2.65 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225m/l226t/s228a mutant apo form

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtxe1:

Sequence; same for both SEQRES and ATOM records:

>d5vtxe1 b.19.1.0 (E:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrmtsarisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

Timeline for d5vtxe1:

• d5vtxe1 first appeared in SCOPe 2.06
  
• d5vtxe1 appears in SCOPe 2.07