Lineage for d5vtzf_ (5vtz F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040945Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)
  8. 3040951Domain d5vtzf_: 5vtz F: [336350]
    Other proteins in same PDB: d5vtza1, d5vtza2, d5vtzc1, d5vtzc2, d5vtze1, d5vtze2
    automated match to d1qfub_
    complexed with nag; mutant

Details for d5vtzf_

PDB Entry: 5vtz (more details), 2.15 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225q/l226a mutant apo form
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5vtzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vtzf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d5vtzf_:

Click to download the PDB-style file with coordinates for d5vtzf_.
(The format of our PDB-style files is described here.)

Timeline for d5vtzf_: