SCOPe 2.08: Domain d5vtre1: 5vtr E:11-325

Lineage for d5vtre1 (5vtr E:11-325)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (58 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d5vtre1: 5vtr E:11-325 [336346]
   Other proteins in same PDB: d5vtra2, d5vtrb_, d5vtrc2, d5vtrd_, d5vtre2, d5vtrf_
   automated match to d4xkga_
   complexed with nag, sia; mutant

Details for d5vtre1

PDB Entry: 5vtr, 2.5 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin g225l/l226s mutant in complex with 6'-sln

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d5vtre1:

Sequence; same for both SEQRES and ATOM records:

>d5vtre1 b.19.1.0 (E:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrlsssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

Timeline for d5vtre1:

• d5vtre1 first appeared in SCOPe 2.06
  
• d5vtre1 appears in SCOPe 2.07