Lineage for d5h7ae3 (5h7a E:132-176)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986264Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1986265Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1986302Protein automated matches [191290] (4 species)
    not a true protein
  7. 1986308Species Staphylococcus aureus [TaxId:1280] [189943] (15 PDB entries)
  8. 1986340Domain d5h7ae3: 5h7a E:132-176 [336316]
    Other proteins in same PDB: d5h7ab5, d5h7ac5
    automated match to d2otke_

Details for d5h7ae3

PDB Entry: 5h7a (more details), 2.7 Å

PDB Description: crystal structure of a repeat protein with four protein a repeat module
PDB Compounds: (E:) Immunoglobulin G-binding protein A

SCOPe Domain Sequences for d5h7ae3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h7ae3 a.8.1.1 (E:132-176) automated matches {Staphylococcus aureus [TaxId: 1280]}
afyeilhlpnlneeqrnafiqslkddpsqsanllaeakklneqqa

SCOPe Domain Coordinates for d5h7ae3:

Click to download the PDB-style file with coordinates for d5h7ae3.
(The format of our PDB-style files is described here.)

Timeline for d5h7ae3:

View in 3D
Domains from other chains:
(mouse over for more information)
d5h7aa1, d5h7aa2, d5h7aa3, d5h7aa4, d5h7ab1, d5h7ab2, d5h7ab3, d5h7ab4, d5h7ab5, d5h7ac1, d5h7ac2, d5h7ac3, d5h7ac4, d5h7ac5, d5h7ad1, d5h7ad2, d5h7ad3, d5h7ad4, d5h7af1, d5h7af2, d5h7af3, d5h7af4, d5h7ag1, d5h7ag2, d5h7ag3, d5h7ag4, d5h7ah1, d5h7ah2, d5h7ah3, d5h7ah4, d5h7ai1, d5h7ai2, d5h7ai3, d5h7ai4, d5h7aj1, d5h7aj2, d5h7aj3, d5h7aj4, d5h7ak1, d5h7ak2, d5h7ak3, d5h7ak4, d5h7al1, d5h7al2, d5h7al3, d5h7al4