SCOPe 2.06: Domain d5tuqa2: 5tuq A:430-554

Lineage for d5tuqa2 (5tuq A:430-554)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (35 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId:11678] [275362] (20 PDB entries)

8. Domain d5tuqa2: 5tuq A:430-554 [336305]
   Other proteins in same PDB: d5tuqa1, d5tuqa3, d5tuqb_
   automated match to d1dloa1
   complexed with j63, mg

Details for d5tuqa2

PDB Entry: 5tuq, 2.71 Å

PDB Description: crystal structure of a 6-cyclohexylmethyl-3-hydroxypyrimidine-2,4- dione inhibitor in complex with hiv reverse transcriptase

PDB Compounds: (A:) hiv-1 reverse transcriptase

SCOPe Domain Sequences for d5tuqa2:

Sequence; same for both SEQRES and ATOM records:

>d5tuqa2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 group m subtype b (isolate bh10) [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsa

Timeline for d5tuqa2:

• d5tuqa2 is new in SCOPe 2.06-stable
  
• d5tuqa2 appears in SCOPe 2.07
  
• d5tuqa2 appears in the current release, SCOPe 2.08