SCOPe 2.08: Domain d5v6va_: 5v6v A:

Lineage for d5v6va_ (5v6v A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d5v6va_: 5v6v A: [336245]
   automated match to d4lyhb_
   complexed with 8ya, ca, gdp, gol

Details for d5v6va_

PDB Entry: 5v6v, 1.72 Å

PDB Description: crystal structure of small molecule aziridine 3 covalently bound to k- ras g12c

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d5v6va_:

Sequence; same for both SEQRES and ATOM records:

>d5v6va_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtagq
eeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlp
srtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhk

Timeline for d5v6va_:

• d5v6va_ first appeared in SCOPe 2.06
  
• d5v6va_ appears in SCOPe 2.07