Lineage for d1c9ra1 (1c9r A:430-558)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124496Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 124506Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 124507Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)
  8. 124566Domain d1c9ra1: 1c9r A:430-558 [33620]
    Other proteins in same PDB: d1c9ra2, d1c9rb1, d1c9rh1, d1c9rh2, d1c9rl1, d1c9rl2

Details for d1c9ra1

PDB Entry: 1c9r (more details), 3.5 Å

PDB Description: crystal structure of met184ile mutant of hiv-1 reverse transcriptase in complex with double stranded dna template-primer

SCOP Domain Sequences for d1c9ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ra1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanaatklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiiealikkeavylawvpahagiggnaavd
alvsagiaa

SCOP Domain Coordinates for d1c9ra1:

Click to download the PDB-style file with coordinates for d1c9ra1.
(The format of our PDB-style files is described here.)

Timeline for d1c9ra1: