Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries) |
Domain d5o0hc1: 5o0h C:1-157 [336196] Other proteins in same PDB: d5o0hc2 automated match to d4rukb_ complexed with 9fn |
PDB Entry: 5o0h (more details), 1.6 Å
SCOPe Domain Sequences for d5o0hc1:
Sequence, based on SEQRES records: (download)
>d5o0hc1 c.26.1.0 (C:1-157) automated matches {Mycobacterium abscessus [TaxId: 561007]} mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap aysfvssslakevatyggdvsallpasvhqrllgklr
>d5o0hc1 c.26.1.0 (C:1-157) automated matches {Mycobacterium abscessus [TaxId: 561007]} mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpagmftvderiemirestadlp nlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapay sfvssslakevatyggdvsallpasvhqrllgklr
Timeline for d5o0hc1: