Lineage for d5o0hc1 (5o0h C:1-157)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119704Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries)
  8. 2119716Domain d5o0hc1: 5o0h C:1-157 [336196]
    Other proteins in same PDB: d5o0hc2
    automated match to d4rukb_
    complexed with 9fn

Details for d5o0hc1

PDB Entry: 5o0h (more details), 1.6 Å

PDB Description: crystal structure of phosphopantetheine adenylyltransferase from mycobacterium abcessus in complex with 2-(4-chloro-3-nitrobenzoyl) benzoic acid (fragment 6)
PDB Compounds: (C:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5o0hc1:

Sequence, based on SEQRES records: (download)

>d5o0hc1 c.26.1.0 (C:1-157) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad
lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap
aysfvssslakevatyggdvsallpasvhqrllgklr

Sequence, based on observed residues (ATOM records): (download)

>d5o0hc1 c.26.1.0 (C:1-157) automated matches {Mycobacterium abscessus [TaxId: 561007]}
mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpagmftvderiemirestadlp
nlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatapay
sfvssslakevatyggdvsallpasvhqrllgklr

SCOPe Domain Coordinates for d5o0hc1:

Click to download the PDB-style file with coordinates for d5o0hc1.
(The format of our PDB-style files is described here.)

Timeline for d5o0hc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5o0hc2