SCOPe 2.06: Domain d5twda_: 5twd A:

Lineage for d5twda_ (5twd A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187306] (66 PDB entries)

8. Domain d5twda_: 5twd A: [336176]
   automated match to d1ylta_

Details for d5twda_

PDB Entry: 5twd, 1.7 Å

PDB Description: ctx-m-14 p167s apoenzyme

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5twda_:

Sequence; same for both SEQRES and ATOM records:

>d5twda_ e.3.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
savqqklaalekssggrlgvalidtadntqvlyrgderfpmcstskvmaaaavlkqsetq
kqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpgg
vtafaraigdetfrldrtestlntaipgdprdtttpramaqtlrqltlghalgetqraql
vtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftqpq
qnaesrrdvlasaariiaeg

Timeline for d5twda_:

• d5twda_ is new in SCOPe 2.06-stable
  
• d5twda_ appears in SCOPe 2.07
  
• d5twda_ appears in the current release, SCOPe 2.08