Lineage for d5nuzb2 (5nuz B:108-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2363884Domain d5nuzb2: 5nuz B:108-213 [336166]
    Other proteins in same PDB: d5nuzb1, d5nuzl1
    automated match to d1h0da2
    complexed with bma, gol, ipa, man, nag

Details for d5nuzb2

PDB Entry: 5nuz (more details), 1.85 Å

PDB Description: junin virus gp1 glycoprotein in complex with an antibody fab fragment
PDB Compounds: (B:) eOD01 light chain

SCOPe Domain Sequences for d5nuzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nuzb2 b.1.1.2 (B:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5nuzb2:

Click to download the PDB-style file with coordinates for d5nuzb2.
(The format of our PDB-style files is described here.)

Timeline for d5nuzb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nuzb1