SCOPe 2.07: Domain d5nuzb1: 5nuz B:0-107

Lineage for d5nuzb1 (5nuz B:0-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d5nuzb1: 5nuz B:0-107 [336165]
   Other proteins in same PDB: d5nuzb2, d5nuzl2
   automated match to d1h0da1
   complexed with bma, gol, ipa, man, nag

Details for d5nuzb1

PDB Entry: 5nuz, 1.85 Å

PDB Description: junin virus gp1 glycoprotein in complex with an antibody fab fragment

PDB Compounds: (B:) eOD01 light chain

SCOPe Domain Sequences for d5nuzb1:

Sequence; same for both SEQRES and ATOM records:

>d5nuzb1 b.1.1.1 (B:0-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gdivltqspaslavslgqratiscrasesvddygisfmnwfqqkpgqppklliytassqg
sgvparfsgsgsgtdfslnihpmeeddtamyfcqqskevpytfgggtkleik

Timeline for d5nuzb1:

• d5nuzb1 first appeared in SCOPe 2.06
  
• d5nuzb1 appears in the current release, SCOPe 2.08