SCOPe 2.07: Domain d5o8ga_: 5o8g A:

Lineage for d5o8ga_ (5o8g A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (6 families)

5. Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
   Pfam PF01230
   topologically similar to the N-terminal domain of protein kinases

6. Protein automated matches [191082] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189791] (33 PDB entries)

8. Domain d5o8ga_: 5o8g A: [336162]
   automated match to d3tw2a_
   complexed with mli

Details for d5o8ga_

PDB Entry: 5o8g, 1.5 Å

PDB Description: crystal structure of human histidine triad nucleotide-binding protein 1 (hhint1) crystallized at p212121 space group, with visible extended fragment of n-terminus

PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5o8ga_:

Sequence; same for both SEQRES and ATOM records:

>d5o8ga_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqis
vaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwp
pg

Timeline for d5o8ga_:

• d5o8ga_ first appeared in SCOPe 2.06
  
• d5o8ga_ does not appear in SCOPe 2.08