SCOP 1.75: Domain d1dtqa1: 1dtq A:430-539

Lineage for d1dtqa1 (1dtq A:430-539)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (14 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (4 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582
   Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584
   Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1dtqa1: 1dtq A:430-539 [33616]
   Other proteins in same PDB: d1dtqa2, d1dtqb_
   complexed with fpt

Details for d1dtqa1

PDB Entry: 1dtq, 2.8 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with pett-1 (pett131a94)

PDB Compounds: (A:) hiv-1 rt a-chain

SCOP Domain Sequences for d1dtqa1:

Sequence, based on SEQRES records:

>d1dtqa1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records):

>d1dtqa1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d1dtqa1:

• d1dtqa1 first appeared (with stable ids) in SCOP 1.55
  
• d1dtqa1 appears in SCOP 1.73
  
• d1dtqa1 appears in SCOPe 2.01
  
• d1dtqa1 appears in the current release, SCOPe 2.08