Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.0: automated matches [191377] (1 protein) not a true family |
Protein automated matches [190459] (50 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [312100] (12 PDB entries) |
Domain d5o0fa_: 5o0f A: [336140] automated match to d4rukb_ complexed with iop |
PDB Entry: 5o0f (more details), 1.7 Å
SCOPe Domain Sequences for d5o0fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5o0fa_ c.26.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]} mtgavcpgsfdpvtlghldvferaaaqfdevivavlinpnkagmftvderiemirestad lpnlrvesgqgllvdfvrerglnaivkglrtgtdfeyelqmaqmnkhiagvdtffvatap aysfvssslakevatyggdvsallpasvhqrllgklr
Timeline for d5o0fa_: