SCOP 1.57: Domain d1ep4a1: 1ep4 A:430-539

Lineage for d1ep4a1 (1ep4 A:430-539)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries)

8. Domain d1ep4a1: 1ep4 A:430-539 [33614]
   Other proteins in same PDB: d1ep4a2, d1ep4b1

Details for d1ep4a1

PDB Entry: 1ep4, 2.5 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with S-1153

SCOP Domain Sequences for d1ep4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ep4a1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Timeline for d1ep4a1:

• d1ep4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ep4a1 appears in SCOP 1.59
  
• d1ep4a1 appears in the current release, SCOPe 2.08